PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK45057.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Trihelix
Protein Properties Length: 678aa    MW: 75232 Da    PI: 6.0947
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK45057.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.11.5e-3055139187
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                 rW+++e+laL+++r++m++++r++ lk+plWe+vs+k+ e g++rs+k+Ckek+en++k+yk++ke++++r++++   +++f+qlea
  KFK45057.1  55 RWPREETLALLRIRSDMDTTFRDATLKAPLWEHVSRKLLELGYKRSAKKCKEKFENVQKYYKRTKETRGGRHDGK--AYKFFSQLEA 139
                 8*********************************************************************86555..5******985 PP

2trihelix104.29.3e-33440524186
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 rW+k e+laLi++r+ me r++++  k+ lWee+s  m++ g++r++k+Ckekwen+nk+ykk+ke++kkr +++ +tcpyf++l+
  KFK45057.1 440 RWPKAEILALINLRSGMEPRYQDNVPKGLLWEEISTSMKRMGYNRNAKRCKEKWENINKYYKKVKESNKKR-PQDAKTCPYFHRLD 524
                 8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.94648112IPR017877Myb-like domain
SMARTSM007170.002752114IPR001005SANT/Myb domain
PfamPF138371.5E-2054140No hitNo description
CDDcd122036.25E-2654119No hitNo description
SMARTSM007170.011437499IPR001005SANT/Myb domain
PfamPF138375.9E-22439524No hitNo description
PROSITE profilePS500906.667439497IPR017877Myb-like domain
CDDcd122031.30E-29440504No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010090Biological Processtrichome morphogenesis
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0042631Biological Processcellular response to water deprivation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MEQAGGGGNE VVEEASPISS RPPANLEELM RFSAADEGGV GGGGGGSSSS SSGNRWPREE  60
TLALLRIRSD MDTTFRDATL KAPLWEHVSR KLLELGYKRS AKKCKEKFEN VQKYYKRTKE  120
TRGGRHDGKA YKFFSQLEAL NTSPPPPLLP PPPPSSSSLD ATPLSVANPP PSSSHHQFSV  180
FPQPQPPQQQ HITHTVSFTT PIPPLPPPLV APTFPGVAFS SHSSSTASGM GSDDEDDEDD  240
MDLDQAAGPS SRKRKRGNRG LGGGKMMELF EGLVRQVMQK QAAMQRSFLE ALEKREQERL  300
DREEAWKRQE MSRLAREHEV MSQERAASAS RDAAIISLIQ KITGHTVQLP PSLSSQPQPP  360
QPPPQTHQPP PAAKRVSTQA VVEQQHSTAQ SQSQPIMAIP QQQILPSPPP STLPPQQQDQ  420
KPQQEMIMSS EQSLSPSSSR WPKAEILALI NLRSGMEPRY QDNVPKGLLW EEISTSMKRM  480
GYNRNAKRCK EKWENINKYY KKVKESNKKR PQDAKTCPYF HRLDLLYRNK VLGSGGGGGV  540
ASSSGLQLQD QITSTVPQQC PVTAMKPPQE GVFNIHQPHH GSGSSEEEEP IEKSPQGTEK  600
PEDLVMRELI QQESMIGEYE KIEESHNYNN MEEDEEELDE EELDEDEKSA AYEIAFQSPT  660
NRGGNNGHTE PPFLTMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197105KRSAKKCKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00177DAPTransfer from AT1G33240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210451e-159AC021045.2 Arabidopsis thaliana chromosome I BAC T9L6 genomic sequence, complete sequence.
GenBankAC0270351e-159AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankAJ0032151e-159AJ003215.1 Arabidopsis thaliana GTL1 gene.
GenBankCP0026841e-159CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013742646.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
SwissprotQ9C8820.0GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLA0A087HSF50.0A0A087HSF5_ARAAL; Uncharacterized protein
STRINGBra040010.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.10.0GT-2-like 1